PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo8G0056900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 318aa    MW: 35136.5 Da    PI: 4.9314
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo8G0056900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.84.3e-092592932155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  Spipo8G0056900 259 KWPYPTEADKIALAEATGLNQKQINNWFINQRKRH 293
                     569*****************************885 PP

2ELK39.31.4e-13213234122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     +LK++LlrKY+gyL++LkqEFs
  Spipo8G0056900 213 DLKDELLRKYGGYLSGLKQEFS 234
                     69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-2177121IPR005540KNOX1
PfamPF037905.5E-2079119IPR005540KNOX1
SMARTSM012564.4E-21127178IPR005541KNOX2
PfamPF037912.6E-21132177IPR005541KNOX2
PROSITE profilePS5121311.121213233IPR005539ELK domain
SMARTSM011889.0E-7213234IPR005539ELK domain
PfamPF037895.0E-10213234IPR005539ELK domain
PROSITE profilePS5007112.617233296IPR001356Homeobox domain
SuperFamilySSF466895.13E-20234311IPR009057Homeodomain-like
SMARTSM003891.6E-12235300IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-28238297IPR009057Homeodomain-like
CDDcd000863.21E-12245297No hitNo description
PfamPF059208.4E-17253292IPR008422Homeobox KN domain
PROSITE patternPS000270271294IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEEMYGLHHH LGFHDHPAAA VVDDLQSLIS RIPGLTAPER MLSSCTDNTT AATEASIAAG  60
GGGGAPSAGA DSVSTSSSVK AMIASHPRYP RLLEAYIDCQ KVGAPPEIAS LLEDIRRDND  120
VFKRGAASVL LGTDPELDEF MEMYCEVLMK YKSDLARPFD EATTFLNSMK LQLSDICKGS  180
CLVSDEAAGS SEDEFGGGDM DAQETQARNE DRDLKDELLR KYGGYLSGLK QEFSKKKKKG  240
KLPKEARQTL LDWWTLHYKW PYPTEADKIA LAEATGLNQK QINNWFINQR KRHWKPSENM  300
QFAVMDNLSS GPFYLDD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248543.11e-128PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-113KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLW1P5151e-127W1P515_AMBTC; Uncharacterized protein
STRINGVIT_01s0127g00210.t011e-120(Vitis vinifera)
STRINGVIT_17s0000g08710.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-105KNOTTED1-like homeobox gene 6